Recombinant Human Cystatin C protein (ab166885)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVV RARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQ IYAVPWQGTMTLSKSTCQDA
    • Molecular weight
      13 kDa
    • Amino acids
      27 to 146
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166885 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituents: PBS, 50% Glycerol

General Info

  • Alternative names
    • AD 8
    • AD8
    • Amyloid angiopathy and cerebral hemorrhage
    • ARMD11
    • bA218C14.4
    • bA218C14.4 (cystatin C)
    • Cst 3
    • Cst3
    • CST3 protein
    • Cystatin 3
    • Cystatin-3
    • Cystatin-C
    • Cystatin3
    • CystatinC
    • CYTC_HUMAN
    • Epididymis secretory protein Li 2
    • Gamma trace
    • Gamma-trace
    • HCCAA
    • HEL S 2
    • MGC117328
    • Neuroendocrine basic polypeptide
    • Post gamma globulin
    • Post-gamma-globulin
    see all
  • Function
    As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.
  • Tissue specificity
    Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in various body fluids, such as the cerebrospinal fluid and plasma. Expressed in highest levels in the epididymis, vas deferens, brain, thymus, and ovary and the lowest in the submandibular gland.
  • Involvement in disease
    Amyloidosis 6
    Macular degeneration, age-related, 11
  • Sequence similarities
    Belongs to the cystatin family.
  • Post-translational
    modifications
    The Thr-25 variant is O-glycosylated with a core 1 or possibly core 8 glycan. The signal peptide of the O-glycosylated Thr-25 variant is cleaved between Ala-20 and Val-21.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab166885.

References

ab166885 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166885.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up