Description

  • Product name

    Recombinant human Cystatin D protein
    See all Cystatin D proteins and peptides
  • Biological activity

    Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AMC.
    The IC50 value is <15 nM.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQ VMAAYQQIVG GVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEF CSFQINEVPWEDKISILNYKCR KV
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      21 to 142
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature form.

Specifications

Our Abpromise guarantee covers the use of ab182715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 97% PBS, 3% Trehalose

    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 50 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage

General Info

  • Alternative names

    • CST 5
    • CST5
    • Cystatin 5
    • Cystatin-5
    • Cystatin-D
    • CystatinD
    • Cysteine proteinase inhibitor
    • CYTD_HUMAN
    • MGC71922
    see all
  • Function

    Cysteine proteinase inhibitor that possibly plays a protective role against proteinases present in the oral cavity. The order of preference for inhibition is cathepsin S > cathepsin H > cathepsin L > cathepsin B.
  • Tissue specificity

    Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in parotid gland but not in seminal vesicle, prostate, epididymis, testis, ovary, placenta, thyroid, gastric corpus, small intestine, liver, or gall bladder tissue.
  • Sequence similarities

    Belongs to the cystatin family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • The purity of ab182715 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue.

References

ab182715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up