Description

  • Product name

    Recombinant human Cystatin D protein
    See all Cystatin D proteins and peptides
  • Biological activity

    The IC50 value is < 2.0 nM. The inhibitory function of Cystatin D on protease activity of papain was measured by a fluorometric assay using Z-FR-AMC at pH 7.5 at 25°C.

  • Purity

    > 90 % SDS-PAGE.
    ab201902 was purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QSRTLAGGIHATDLNDKSVQRALDFAISEYNKVINKDEYYSRPLQVMAAY QQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINE VPWEDKISILNYKCRKVHHHHHH
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      26 to 142
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_001891.

Specifications

Our Abpromise guarantee covers the use of ab201902 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CST 5
    • CST5
    • Cystatin 5
    • Cystatin-5
    • Cystatin-D
    • CystatinD
    • Cysteine proteinase inhibitor
    • CYTD_HUMAN
    • MGC71922
    see all
  • Function

    Cysteine proteinase inhibitor that possibly plays a protective role against proteinases present in the oral cavity. The order of preference for inhibition is cathepsin S > cathepsin H > cathepsin L > cathepsin B.
  • Tissue specificity

    Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in parotid gland but not in seminal vesicle, prostate, epididymis, testis, ovary, placenta, thyroid, gastric corpus, small intestine, liver, or gall bladder tissue.
  • Sequence similarities

    Belongs to the cystatin family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab201902 (3µg).

    ab201902 migrates at 13.5-18kDa in SDS-PAGE under reducing conditions.

References

ab201902 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201902.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up