Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SSSKEENRIIPGGIYDADLNDEWVQRALHFAISEYNKATEDEYYRRPLQV LRAREQTFGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF EIYEVPWEDRMSLVNSRCQEAVDHHHHHH
    • Molecular weight

      15 kDa including tags
    • Amino acids

      21 to 141
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151348 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 5.50
    Constituents: 0.39% MES, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • Cst4
    • Cystatin 4
    • Cystatin S precursor
    • Cystatin SA III
    • Cystatin-4
    • Cystatin-S
    • Cystatin-SA-III
    • CYTS_HUMAN
    • MGC71923
    • Salivary acidic protein 1
    see all
  • Function

    This protein strongly inhibits papain and ficin, partially inhibits stem bromelain and bovine cathepsin C, but does not inhibit porcine cathepsin B or clostripain. Papain is inhibited non-competitively.
  • Tissue specificity

    Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid.
  • Sequence similarities

    Belongs to the cystatin family.
  • Post-translational
    modifications

    Phosphorylated at both its N- and C-terminal regions.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab151348 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151348.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up