Description

  • Product name

    Recombinant Human Cystatin S protein
    See all Cystatin S proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SSSKEENRIIPGGIYDADLNDEWVQRALHFAISEYNKATEDEYYRRPLQV LRAREQTFGG VNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLC SFEIYEVPWEDRMSLVNSRCQE A
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      21 to 141
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included (AAH65714).

Specifications

Our Abpromise guarantee covers the use of ab220461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 6.0
    Constituents: 0.87% Sodium chloride, 5% Trehalose, 0.49% MES

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Cst4
    • Cystatin 4
    • Cystatin S precursor
    • Cystatin SA III
    • Cystatin-4
    • Cystatin-S
    • Cystatin-SA-III
    • CYTS_HUMAN
    • MGC71923
    • Salivary acidic protein 1
    see all
  • Function

    This protein strongly inhibits papain and ficin, partially inhibits stem bromelain and bovine cathepsin C, but does not inhibit porcine cathepsin B or clostripain. Papain is inhibited non-competitively.
  • Tissue specificity

    Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid.
  • Sequence similarities

    Belongs to the cystatin family.
  • Post-translational
    modifications

    Phosphorylated at both its N- and C-terminal regions.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab220461 stained overnight with Coomassie Blue.

    The protein migrates as 15 kDa under reducing condition (SDS-PAGE).

References

ab220461 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up