Description

  • Product name

    Recombinant Human Cystatin SN/CST1 protein
    See all Cystatin SN/CST1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab116170 is purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMWSPKEEDRIIPGGIYNADLNDEWVQR ALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTK SQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKS RCQES
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      21 to 141
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Cystatin SN

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 10% Glycerol, 0.58% Sodium chloride, 0.32% Tris HCl, 0.03% DTT

General Info

  • Alternative names

    • CST1
    • Cystain SAI
    • Cystain-SA-I
    • Cystatin 1
    • Cystatin-1
    • Cystatin-SN
    • Cystatin1
    • Cysteine proteinase inhibitor, type 2 family
    • CYTN
    • CYTN_HUMAN
    • Salivary cystatin SA1
    • Salivary cystatin-SA-1
    see all
  • Function

    Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to cystatin S but that differ in their specificity due to amino acid sequence differences. Cystatin SN, with a pI of 7.5, is a much better inhibitor of papain and dipeptidyl peptidase I than is cystatin S, although both inhibit ficin equally well.
  • Tissue specificity

    Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid.
  • Sequence similarities

    Belongs to the cystatin family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab116170 at approximately 16.9kDa (3µg).

References

ab116170 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up