Recombinant Human Cytochrome b-c1 complex subunit 9/UQCR10 protein (ab162235)

Overview

  • Product name

    Recombinant Human Cytochrome b-c1 complex subunit 9/UQCR10 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEG KLWKHIKHKYENK
    • Amino acids

      1 to 63
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162235 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Cytochrome b-c1 complex subunit 9

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cytochrome c1 non heme 7 kDa protein
    • Cytochrome C1 nonheme 7kDa protein
    • HSPC051
    • HSPC119
    • HSPC151
    • QCR9
    • Ubiquinol cytochrome c reductase complex
    • Ubiquinol cytochrome c reductase complex (7.2 kD)
    • Ubiquinol cytochrome c reductase complex 7.2 kDa protein
    • Ubiquinol cytochrome c reductase complex III subunit X
    • Ubiquinol cytochrome c reductase complex III subunit X 7.2kDa
    • UCCR7.2
    • UCRC
    • UQCR10
    see all
  • Relevance

    Function: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1. Similarity: Belongs to the UQCR10/QCR9 family.
  • Cellular localization

    Mitochondrial; Mitochondrion inner membrane

Images

  • ab162235 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162235 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162235.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up