Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLEL KNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGR GDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQRE AHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLM YLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERV KEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAG TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYM DAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDN QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL LCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS
    • Amino acids
      1 to 493
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158253 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4-nitrophenol 2-hydroxylase
    • CP2E1_HUMAN
    • CPE1
    • CYP2E
    • Cyp2e1
    • CYPIIE1
    • Cytochrome P450 2E1
    • Cytochrome P450 isozyme 3A
    • Cytochrome P450 LM3A
    • Cytochrome P450, family 2, subfamily e, polypeptide 1
    • Cytochrome P450, subfamily IIE
    • cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1
    • Cytochrome P450-ALC
    • Cytochrome P450-J
    • Cytochrome P450RLM6
    • EC 1.14.13.-
    • EC 1.14.13.n7
    • Ethanol-inducible P450
    • Flavoprotein-linked monooxygenase
    • MGC133529
    • Microsomal monooxygenase
    • OTTHUMP00000020813
    • OTTHUMP00000046571
    • P450 ALC
    • P450-J
    • P450C2E
    • P450J
    • P450RLM6
    • Xenobiotic monooxygenase
    see all
  • Function
    Metabolizes several precarcinogens, drugs, and solvents to reactive metabolites. Inactivates a number of drugs and xenobiotics and also bioactivates many xenobiotic substrates to their hepatotoxic or carcinogenic forms.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Images

  • ab158253 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158253 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158253.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up