Description

  • Product name

    Recombinant Human Cytochrome P450 Reductase protein
  • Purity

    > 95 % SDS-PAGE.
    assessed by densitometry
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      INMGDSHVDTSSTVSEAVAEEVSLFSMTDMILFSLIVGLLTYWFLFRKKK EEVPEFTKIQTLTSSVRESSFVEKMKKTGRNIIVFYGSQTGTAEEFANRL SKDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATYGEGDPTDN AQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQ RIFELGLGDDDGNLEEDFITWREQFWLAVCEHFGVEATGEESSIRQYELV VHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTER HLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLDVVMSL NNLDEESNKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSE QELLRKMASSSGEGKELYLSWVVEARRHILAILQDCPSLRPPIDHLCELL PRLQARYYSIASSSKVHPNSVHICAVVVEYETKAGRINKGVATNWLRAKE PVGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPFIGFIQERA WLRQQGKEVGETLLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSRE QSHKVYVQHLLKQDREHLWKLIEGGAHIYVCGDARNMARDVQNTFYDIVA ELGAMEHAQAVDYIKKLMTKGRYSLDVWS
    • Predicted molecular weight

      102 kDa including tags
    • Amino acids

      1 to 679
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab151823 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.04% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names

    • CPR
    • CYPOR
    • Cytochrome p450 oxidoreductase
    • DKFZp686G04235
    • FLJ26468
    • NADPH Cytochrome P450 Reductase
    • NADPH dependent cytochrome P450 reductase
    • NADPH--cytochrome P450 reductase
    • NCPR_HUMAN
    • P450 (cytochrome) oxidoreductase
    • P450 Cytochrome Oxidoreductase
    • P450R
    • por
    see all
  • Function

    This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5.
  • Involvement in disease

    Defects in POR are the cause of adrenal hyperplasia variant type (AHV) [MIM:201750]; also known as Antley-Bixler syndrome-like phenotype with disordered steroidogenesis. AHV is a rare variant of congenital adrenal hyperplasia. It is an autosomal recessive disorder with apparent combined P450C17 and P450C21 deficiency. Affected girls are born with ambiguous genitalia, but their circulating androgens are low and virilization does not progress. Conversely, affected boys are sometimes born undermasculinized. Boys and girls can also present with bone malformations, in some cases resembling the pattern seen in patients with Antley-Bixler syndrome.
    Defects in POR are a cause of isolated disordered steroidogenesis (IDS) [MIM:201750].
  • Sequence similarities

    In the C-terminal section; belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
    Contains 1 FAD-binding FR-type domain.
    Contains 1 flavodoxin-like domain.
  • Cellular localization

    Endoplasmic reticulum membrane. Anchored to the ER membrane by its N-terminal hydrophobic region.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab151823 which was determined to be >95% pure by densitometry.

References

ab151823 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151823.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up