Overview

  • Product name

    Recombinant Human Cytokeratin 15 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MTTTFLQTSSSTFGGGSTRGGSLLAGGGGFGGGSLSGGGGSRSISASSAR FVSSGSGGGYGGGMRVCGFGGGAGSVFGGGFGGGVGGGFGGGFGGGDGGL LSGNEKITMQNLNDRLASYLDKVRALEEANADLEVKIHDWYQKQTPTSPE CDYSQYFKTIEELRDKIMATTIDNSRVILEIDNARLAADDFRLKYENELA LRQGVEADINGLRRVLDELTLARTDLEMQIEGLNEELAYLKKNHEEEMKE FSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSK TEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSL AETECRYATQLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLE QEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVS SHKREI
    • Amino acids

      1 to 456
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158804 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AI528832
    • CK 15
    • CK-15
    • CK15
    • Cytokeratin-15
    • Cytokeratin15
    • K15
    • K1C15_HUMAN
    • K1CO
    • Ka15
    • Keratin
    • Keratin 15
    • Keratin 15 basic
    • Keratin 15 beta
    • Keratin complex 1 acidic gene 15
    • Keratin type I cytoskeletal 15
    • Keratin-15
    • Keratin15
    • KRT 15
    • Krt1-15
    • KRT15
    • KRTB
    • KRTL15
    • Type I cytoskeletal 15
    • Type I keratin Ka15
    see all
  • Tissue specificity

    Expressed in a discontinuous manner in the basal cell layer of adult skin epidermis, but continuously in the basal layer of fetal skin epidermis and nail. Also expressed in the outer root sheath above the hair bulb in hair follicle (at protein level). Expressed homogeneously in all cell layers of the esophagus and exocervix, but detected in the basal cell layer only of oral mucosa, skin and in the basal plus the next two layers of the suprabasal epithelium of the palate.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Information by UniProt

Images

  • ab158804 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158804 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158804.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up