Description

  • Product name

    Recombinant Human Cytokeratin 16/K16 protein (denatured)
    See all Cytokeratin 16/K16 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMTTCSRQFTSSSSMKGSCGIGGGIGGG SSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGGACGLGGGYGGGFSSSSS FGSGFGGGYGGGLGAGFGGGLGAGFGGGFAGGDGLLVGSEKVTMQNLNDR LASYLDKVRALEEANADLEVKIRDWYQRQRPSEIKDYSPYFKTIEDLRNK IIAATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVL DELTLARTDLEMQIEGLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAA PGVDLSRILNEMRDQYEQMAEKNRRDAETWFLSKTEELNKEVASNSELVQ SSRSEVTELRRVLQGLEIELQSQLSMKASLENSLEETKGRYCMQLSQIQG LIGSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRLLEGEDAH LSSQQASGQSYSSREVFTSSSSSSSRQTRPILKEQSSSSFSQGQSS
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      1 to 473
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab177600 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Cytokeratin 16. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • CK 16
    • CK-16
    • CK16
    • Cytokeratin 16
    • Cytokeratin-16
    • Cytokeratin16
    • FNEPPK
    • Focal non epidermolytic palmoplantar keratoderma
    • K 16
    • K16
    • K1C16_HUMAN
    • K1CP
    • Keratin
    • Keratin 1 type I
    • Keratin 16
    • Keratin type I cytoskeletal 16
    • Keratin-16
    • Keratin16
    • KRT 16
    • Krt16
    • KRT16A
    • NEPPK
    • PC1
    • type I cytoskeletal 16
    see all
  • Tissue specificity

    Expressed in the hair follicle, nail bed and in mucosal stratified squamous epithelia and, suprabasally, in oral epithelium and palmoplantar epidermis. Also found in luminal cells of sweat and mammary gland ducts.
  • Involvement in disease

    Defects in KRT16 are a cause of pachyonychia congenita type 1 (PC1) [MIM:167200]; also known as Jadassohn-Lewandowsky syndrome. PC1 is an autosomal dominant ectodermal dysplasia characterized by hypertrophic nail dystrophy resulting in onchyogryposis (thickening and increase in curvature of the nail), palmoplantar keratoderma, follicular hyperkeratosis, and oral leukokeratosis. Hyperhidrosis of the hands and feet is usually present.
    Defects in KRT16 are the cause of palmoplantar keratoderma non-epidermolytic focal (FNEPPK) [MIM:613000]. A dermatological disorder characterized by non-epidermolytic palmoplantar keratoderma limited to the pressure points on the balls of the feet, with later mild involvement on the palms. Oral, genital and follicular keratotic lesions are often present.
    Defects in KRT16 are a cause of unilateral palmoplantar verrucous nevus (UPVN) [MIM:144200]. UPVN is characterized by a localized thickening of the skin in parts of the right palm and the right sole.
    Note=KRT16 and KRT17 are coexpressed only in pathological situations such as metaplasias and carcinomas of the uterine cervix and in psoriasis vulgaris.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab177600 (3µg).

References

ab177600 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177600.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up