Description

  • Product name

    Recombinant Human Cytokeratin 2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNRQVCKKSFSGRSQGFSGRSAVVSGSSRMSCVARSGGAGGGACGFRSGA GSFGSRSLYNLGSNKSISISVAAGSSRAGGFGGGRSSCGFAGGYGGGFGG SYGGGFGGGRGVGSGFGGAGGFGGAGGFGGPGVFGGPGSFGGPGGFGPGG FPGGIQEVIVNQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDK VRFLEQQNKVLETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLG ERGNLEGELKSMQDLVEDFKKKYEDEINKRTAAENEFVGLKKDVDAAFMN KVELQAKVDSLTDEVSFLRTLYEMELSQMQSHASDTSVVLSMDNNRCLDL GSIIAEVRTQYEEIAQRSKSEAEALYQTKLGELQTTAGRHGDDLRNTKSE IMELNRMIQRLRAEIENVKKQNANLQTAIAEAEQRGEMALKDANAKLQDL QTALQKAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGEC QSAVCISVVSNVTSTSGSSGSSRGVFGGVSGSGSGGYKGGSSSSSSSGYG VSGGSGSGYGGVSSGSTGGRGSSGSYQSSSSGSRLGGAGSISVSHSGMGS SSGSIQTSGGSGYKSGGGGSTSIRFSQTTSSSQHSSTK
    • Amino acids

      1 to 638
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162518 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CK 2P
    • CK-2P
    • CK2P
    • Cytokeratin 2P
    • Cytokeratin-2P
    • Cytokeratin2
    • Cytokeratin2P
    • HUMCYT 2A
    • HUMCYT2A
    • K22O_HUMAN
    • K2P
    • K76
    • KB9
    • Keratin
    • Keratin 2p
    • Keratin 76
    • Keratin 76, type II
    • Keratin type II cytoskeletal 2 oral
    • Keratin-76
    • Keratin2p
    • Keratin76
    • KRT 2B
    • KRT 2P
    • KRT 76
    • KRT2B
    • KRT2P
    • KRT76
    • type II cytoskeletal 2 oral
    • Type-II keratin Kb9
    see all
  • Function

    Probably contributes to terminal cornification.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Developmental stage

    Synthesized during maturation of epidermal keratinocytes.
  • Information by UniProt

Images

  • ab162518 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162518 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162518.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up