Recombinant Human Cytokeratin 20 protein (ab211958)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human Cytokeratin 20 protein -
Purity
> 90 % SDS-PAGE.
Expressed in E. coli as inclusion bodies, refolded using temperature shift inclusion body refolding technology, chromatographically purified and sterile-filtered. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MASMTGGQQMGRGHHHHHHGNLYFQGEFDFSRRSFHRSLSSSLQAPVVST VGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMA MQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRAGRDYSAYYRQ IEELRSQIKDAQLQNARCVLQIDNAKLAAEDFRLKYETERGIRLTVEADL QGLNKVFDDLTLHKTDLEIQIEELNKDLALLKKEHQEEVDGLHKHLGNTV NVEVDAAPGLNLGVIMNEMRQKYEVMAQKNLQEAKEQFERQTAVLQQQVT VNTEELKGTEVQLTELRRTSQSLEIELQSHLSMKESLEHTLEETKARYSS QLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIKTRLEQEIATYRRL LEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEVEEN I -
Predicted molecular weight
52 kDa including tags -
Amino acids
2 to 424 -
Additional sequence information
Constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. (NP_061883).
-
Associated products
-
Related Products
- Anti-Cytokeratin 20 antibody [EPR1621(2)] - Cytoskeleton Marker (ab109111)
- Anti-TEV Tag antibody [KT88] (ab179875)
- Anti-6X His tag® antibody [HIS.H8] (ab18184)
- Anti-6X His tag® antibody [4D11] (ab5000)
- Anti-Cytokeratin 20 antibody (ab53120)
- Anti-Cytokeratin 20 antibody [EPR1622Y] - Cytoskeleton Marker (ab76126)
- Anti-Cytokeratin 20 antibody [Ks20.8] (ab854)
- Anti-6X His tag® antibody (ab9108)
- Anti-T7 tag® antibody (ab9115)
- Anti-Cytokeratin 20 antibody - Cytoskeleton Marker (ab97511)
Specifications
Our Abpromise guarantee covers the use of ab211958 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Additional notes
ab211958 may be used for in vitro Cytokeratin 20 mediated cellular cytoskeletal polymerization regulation study for cell stress induced apoptosis by intracellular delivery of this protein; it mtay be used for mapping PTP4A3 protein-protein interaction; as potential biomarker protein for clinical applications such as monitoring various cancer progression by measuring tissue sample Cytokeratin 20 protein expression level; as antigen for specific antibody production. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C.
pH: 8.00
Constituent: 0.32% Tris HCl
Contains NaCl, KCl, EDTA, Sucrose and DTT.
General Info
-
Alternative names
- CD20
- CK 20
- CK-20
see all -
Function
Plays a significant role in maintaining keratin filament organization in intestinal epithelia. When phosphorylated, plays a role in the secretion of mucin in the small intestine. -
Tissue specificity
Expressed predominantly in the intestinal epithelium. Expressed in luminal cells of colonic mucosa. Also expressed in the Merkel cells of keratinized oral mucosa; specifically at the tips of some rete ridges of the gingival mucosa, in the basal layer of the palatal mucosa and in the taste buds of lingual mucosa. -
Sequence similarities
Belongs to the intermediate filament family. -
Developmental stage
First detected at embryonic week 8 in individual 'converted' simple epithelial cells of the developing intestinal mucosa. In later fetal stages, synthesis extends over most goblet cells and a variable number of villus enterocytes. In the developing gastric and intestinal mucosa, expressed in all enterocytes and goblet cells as well as certain 'low-differentiated' columnar cells, whereas the neuroendocrine and Paneth cells are negative. -
Post-translational
modificationsHyperphosphorylation at Ser-13 occurs during the early stages of apoptosis but becomes less prominent during the later stages. Phosphorylation at Ser-13 also increases in response to stress brought on by cell injury.
Proteolytically cleaved by caspases during apoptosis. Cleavage occurs at Asp-228. -
Cellular localization
Cytoplasm. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab211958 has not yet been referenced specifically in any publications.