Description

  • Product name

    Recombinant Human Cytokeratin 20 protein
    See all Cytokeratin 20 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Expressed in E. coli as inclusion bodies, refolded using temperature shift inclusion body refolding technology, chromatographically purified and sterile-filtered.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGEFDFSRRSFHRSLSSSLQAPVVST VGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMA MQNLNDRLASYLEKVRTLEQSNSKLEVQIKQWYETNAPRAGRDYSAYYRQ IEELRSQIKDAQLQNARCVLQIDNAKLAAEDFRLKYETERGIRLTVEADL QGLNKVFDDLTLHKTDLEIQIEELNKDLALLKKEHQEEVDGLHKHLGNTV NVEVDAAPGLNLGVIMNEMRQKYEVMAQKNLQEAKEQFERQTAVLQQQVT VNTEELKGTEVQLTELRRTSQSLEIELQSHLSMKESLEHTLEETKARYSS QLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIKTRLEQEIATYRRL LEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEVEEN I
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      2 to 424
    • Additional sequence information

      Constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. (NP_061883).

Specifications

Our Abpromise guarantee covers the use of ab211958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C.

General Info

  • Alternative names

    • CD20
    • CK 20
    • CK-20
    • CK20
    • Cytokeratin-20
    • Cytokeratin20
    • K1C20_HUMAN
    • K20
    • KA20
    • Keratin
    • Keratin 20
    • keratin 20, type I
    • keratin 21, rat, homolog of
    • Keratin type I cytoskeletal 20
    • Keratin-20
    • Keratin20
    • KRT 20
    • KRT 21
    • KRT20
    • KRT21
    • MGC35423
    • OTTHUMP00000164518
    • Protein IT
    • type I cytoskeletal 20
    see all
  • Function

    Plays a significant role in maintaining keratin filament organization in intestinal epithelia. When phosphorylated, plays a role in the secretion of mucin in the small intestine.
  • Tissue specificity

    Expressed predominantly in the intestinal epithelium. Expressed in luminal cells of colonic mucosa. Also expressed in the Merkel cells of keratinized oral mucosa; specifically at the tips of some rete ridges of the gingival mucosa, in the basal layer of the palatal mucosa and in the taste buds of lingual mucosa.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Developmental stage

    First detected at embryonic week 8 in individual 'converted' simple epithelial cells of the developing intestinal mucosa. In later fetal stages, synthesis extends over most goblet cells and a variable number of villus enterocytes. In the developing gastric and intestinal mucosa, expressed in all enterocytes and goblet cells as well as certain 'low-differentiated' columnar cells, whereas the neuroendocrine and Paneth cells are negative.
  • Post-translational
    modifications

    Hyperphosphorylation at Ser-13 occurs during the early stages of apoptosis but becomes less prominent during the later stages. Phosphorylation at Ser-13 also increases in response to stress brought on by cell injury.
    Proteolytically cleaved by caspases during apoptosis. Cleavage occurs at Asp-228.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab211958 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up