Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGA CGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGF GFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNL QIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWTLLQE QGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELRGMQDLVEDFK NKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRA EAESWYQTKYEELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKK QCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQE LMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGGA SGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIK YTTTSSSSRKSYKH
    • Amino acids
      1 to 564
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158802 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CK-6A
    • CK-6D
    • CK6A
    • CK6C
    • CK6D
    • Cytokeratin-6A
    • Cytokeratin-6D
    • K2C6A_HUMAN
    • K6A
    • K6C
    • K6D
    • Keratin
    • keratin 6A
    • Keratin, type II cytoskeletal 6A
    • Keratin-6A
    • Krt6a
    • KRT6C
    • KRT6D
    • type II cytoskeletal 6A
    • Type-II keratin Kb6
    see all
  • Tissue specificity
    Constitutively expressed in distinct types of epithelia such as those in oral mucosa, esophagus, papillae of tongue and hair follicle outer root sheath.
  • Involvement in disease
    Defects in KRT6A are a cause of pachyonychia congenita type 1 (PC1) [MIM:167200]; also known as Jadassohn-Lewandowsky syndrome. PC1 is an autosomal dominant ectodermal dysplasia characterized by hypertrophic nail dystrophy resulting in onchyogryposis (thickening and increase in curvature of the nail), palmoplantar keratoderma, follicular hyperkeratosis, and oral leukokeratosis. Hyperhidrosis of the hands and feet is usually present.
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Information by UniProt

Images

  • ab158802 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158802 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158802.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up