Overview

  • Product name

    Recombinant Human Cytokeratin 7 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVA VRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNN KFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRG QLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKD VDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMD NSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDD LRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDA RAKQEELEAALQRAKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEE SRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPG LLKAYSIRTASASRRSARD
    • Molecular weight

      78 kDa including tags
    • Amino acids

      1 to 469
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CK 7
    • CK-7
    • CK7
    • Cytokeratin 7
    • Cytokeratin-7
    • D15Wsu77e
    • K2C7
    • K2C7_HUMAN
    • K7
    • Keratin 7
    • Keratin 7, type II
    • Keratin type II cytoskeletal 7
    • Keratin, 55K type II cytoskeletal
    • Keratin, simple epithelial
    • Keratin, simple epithelial type I, K7
    • Keratin, type II cytoskeletal 7
    • Keratin-7
    • Krt2-7
    • KRT7
    • MGC11625
    • MGC129731
    • MGC3625
    • Sarcolectin
    • SCL
    • Type II mesothelial keratin K7
    • Type-II keratin Kb7
    see all
  • Function

    Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).
  • Tissue specificity

    Expressed in cultured epidermal, bronchial and mesothelial cells but absent in colon, ectocervix and liver. Observed throughout the glandular cells in the junction between stomach and esophagus but is absent in the esophagus.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Post-translational
    modifications

    Arg-20 is dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132933 stained with Coomassie Blue

References

ab132933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up