Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSIRVTQKSYKVSTSGPRAFSSRSYTS GPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLV LEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQ QQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKN KYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQL YEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAE AESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQ RASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQEL MNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYAGGLSSAY GGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSES SDVLPK
    • Molecular weight
      56 kDa including tags
    • Amino acids
      1 to 483
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab156970 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • CARD2
    • CK 8
    • CK-8
    • CK8
    • CYK8
    • CYKER
    • Cytokeratin endo A
    • Cytokeratin-8
    • DreK8
    • EndoA
    • K2C8
    • K2C8_HUMAN
    • K8
    • Keratin 8
    • Keratin type II cytoskeletal 8
    • Keratin, type II cytoskeletal 8
    • Keratin-8
    • KO
    • Krt 2.8
    • KRT8
    • MGC118110
    • MGC174782
    • MGC53564
    • MGC85764
    • sb:cb186
    • Type-II keratin Kb8
    see all
  • Function
    Together with KRT19, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.
  • Tissue specificity
    Observed in muscle fibers accumulating in the costameres of myoplasm at the sarcolemma membrane in structures that contain dystrophin and spectrin. Expressed in gingival mucosa and hard palate of the oral cavity.
  • Involvement in disease
    Cirrhosis
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Post-translational
    modifications
    Phosphorylation on serine residues is enhanced during EGF stimulation and mitosis. Ser-74 phosphorylation plays an important role in keratin filament reorganization.
    O-glycosylated. O-GlcNAcylation at multiple sites increases solubility, and decreases stability by inducing proteasomal degradation.
    O-glycosylated (O-GlcNAcylated), in a cell cycle-dependent manner.
  • Cellular localization
    Cytoplasm. Nucleus, nucleoplasm. Nucleus matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156970 (3 µg).

References

This product has been referenced in:
  • Goldie BJ  et al. miRNA Enriched in Human Neuroblast Nuclei Bind the MAZ Transcription Factor and Their Precursors Contain the MAZ Consensus Motif. Front Mol Neurosci 10:259 (2017). Read more (PubMed: 28878619) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up