Description

  • Product name

    Recombinant Human Cytokeratin 8 protein (Tagged)
    See all Cytokeratin 8 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLG GGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNK FASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQL ETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVD EAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNS RSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLR RTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANA KLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESR LESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSS FSRTSSSRAVVVKKIETRDGKLVSESSDVLPK
    • Predicted molecular weight

      70 kDa including tags
    • Amino acids

      2 to 483
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO-tag.

Specifications

Our Abpromise guarantee covers the use of ab235816 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • CARD2
    • CK 8
    • CK-8
    • CK8
    • CYK8
    • CYKER
    • Cytokeratin endo A
    • Cytokeratin-8
    • DreK8
    • EndoA
    • K2C8
    • K2C8_HUMAN
    • K8
    • Keratin 8
    • Keratin type II cytoskeletal 8
    • Keratin, type II cytoskeletal 8
    • Keratin-8
    • KO
    • Krt 2.8
    • KRT8
    • MGC118110
    • MGC174782
    • MGC53564
    • MGC85764
    • sb:cb186
    • Type-II keratin Kb8
    see all
  • Function

    Together with KRT19, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.
  • Tissue specificity

    Observed in muscle fibers accumulating in the costameres of myoplasm at the sarcolemma membrane in structures that contain dystrophin and spectrin. Expressed in gingival mucosa and hard palate of the oral cavity.
  • Involvement in disease

    Cirrhosis
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Post-translational
    modifications

    Phosphorylation on serine residues is enhanced during EGF stimulation and mitosis. Ser-74 phosphorylation plays an important role in keratin filament reorganization.
    O-glycosylated. O-GlcNAcylation at multiple sites increases solubility, and decreases stability by inducing proteasomal degradation.
    O-glycosylated (O-GlcNAcylated), in a cell cycle-dependent manner.
  • Cellular localization

    Cytoplasm. Nucleus, nucleoplasm. Nucleus matrix.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235816.

References

ab235816 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235816.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up