Description

  • Product name

    Recombinant human D Amino Acid Oxidase protein
    See all D Amino Acid Oxidase proteins and peptides
  • Biological activity

    Specific activity: >3.5 units/mg, in which one unit will oxidatively deaminate 1.0 µmole of D-alanine to pyruvate per minute at pH 8.5 at 37°C, in the presence of catalase.

  • Purity

    > 90 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMRVVVIGAGVIGLSTALCIHERYHSVLQPL DIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHVH SPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGY GWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYII PGTQTVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERT GFRPVRPQIRLEREQLRTGPSNTEVIHNYGHGGYGLTIHWGCALEAAKLF GRILEEKKLSRMPPSHL
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      1 to 347
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_001908.

Specifications

Our Abpromise guarantee covers the use of ab208461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 20% Glycerol, 0.02% DTT, 0.32% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • D-amino-acid oxidase
    • DAAO
    • DAMOX
    • DAO
    • DAO1
    • EC 1.4.3.3
    • MGC35381
    • OXDA
    • OXDA_HUMAN
    see all
  • Function

    Regulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids.
  • Sequence similarities

    Belongs to the DAMOX/DASOX family.
  • Cellular localization

    Peroxisome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab208461 (3μg).

References

ab208461 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up