Recombinant Human D-aspartate oxidase protein (ab160076)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELL ARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL
    • Amino acids
      270 to 369
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160076 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D aspartate oxidase
    • D-aspartate oxidase
    • DASOX
    • DDO
    • DDO 1
    • DDO 2
    • FLJ45203
    • OTTHUMP00000017000
    • OXDD_HUMAN
    see all
  • Function
    Selectively catalyzes the oxidative deamination of D-aspartate and its N-methylated derivative, N-methyl D-aspartate.
  • Sequence similarities
    Belongs to the DAMOX/DASOX family.
  • Cellular localization
    Peroxisome.
  • Information by UniProt

Images

  • ab160076 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160076 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160076.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up