Description

  • Product name

    Recombinant Human DAB2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKY KAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLS GIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIK TGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKIEEASKAVENGSEALMILD DQTNKLKSGVDQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSL RENPFLTNGITSCSLPRPTPQASFLPENAFSANLNFFPTPNPDPFRDDPF TQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQI SNRTGKQEAQAGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVG SPPKGLSIQNGVKQDLESSVQSSPHDSIAIIPPPQSTKPGRGRRTAKSSA NDLLASDIFAPPVSEPSGQASPTGQPTALQPNPLDLFKTSAPAPVGPLVG LGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGFSQPVIFGTSP AVSGWNQPSPFAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFP APAVSTQPPSMHSSLLVTPPQPPPRAGPPKDISSDAFTALDPLGDKEIKD VKEMFKDFQLWQPPAVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHD DFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASV ASSQPVSSEMYRDPFGNPFA
    • Predicted molecular weight

      110 kDa including tags
    • Amino acids

      1 to 770

Specifications

Our Abpromise guarantee covers the use of ab132218 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DAB 2
    • Dab, mitogen-responsive phosphoprotein, homolog 2 (Drosophila)
    • DAB2
    • Differentially expressed in ovarian cancer 2
    • Differentially expressed protein 2
    • Disabled (Drosophila) homolog 2 (mitogen responsive phosphoprotein)
    • Disabled homolog 2
    • Disabled homolog 2 mitogen responsive phosphoprotein
    • Disabled homolog 2 mitogen responsive phosphoprotein (Drosophila)
    • Disabled, Drosophila, homolog of, 2
    • DOC 2
    • DOC2
    • FLJ26626
    • Mitogen responsive phosphoprotein
    see all
  • Relevance

    DAB2 is a component of the CSF1 signal transduction pathway. DAB2 mRNA is expressed in normal ovarian epithelial cells but is down regulated or absent from ovarian carcinoma cell lines. The down regulation of DAB2 may play an important role in ovarian carcinogenesis. This gene was initially named DOC2 (for Differentially expressed in Ovarian Cancer) and is distinct from the DOC2A and DOC2B genes (for double C2 like domains, alpha and beta).
  • Cellular localization

    Cytoplasmic vesicle; clathrin coated vesicle; clathrin coated vesicle membrane. Cell membrane; coated pit; clathrin coated pit. Note: Colocalizes with large insert containing isoforms of MYO6 at clathrin coated pits/vesicles.

Images

  • 12.5% SDS-PAGE analysis of ab132218 stained with Coomassie Blue.

References

ab132218 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132218.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up