Description

  • Product name

    Recombinant Human DAI protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLY RMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPGNCHPGEAGLTLQG ASWQWTSTDLSLGSNLNSATWELTGFLSLCLGFFFWLMELTAGLLGRGC
    • Amino acids

      1 to 149
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153528 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Z DNA binding protein

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C20orf183
    • DAI
    • DLM 1
    • DLM1
    • DNA-dependent activator of interferon regulatory factors
    • DNA-dependent activator of IRFs
    • OTTHUMP00000031373
    • OTTHUMP00000174290
    • OTTHUMP00000237854
    • Tumor stroma and activated macrophage protein DLM 1
    • Tumor stroma and activated macrophage protein DLM-1
    • Z-DNA-binding protein 1
    • ZBP 1
    • Zbp1
    • ZBP1_HUMAN
    • ZDBP1
    see all
  • Function

    May play a role in host defense against tumors and pathogens. Binds Z-DNA.
  • Tissue specificity

    Highly expressed in lymphatic tissues including lymph node, leukocytes, tonsil, bone marrow and spleen. Expressed to a lesser extent in thymus, lung and liver.
  • Sequence similarities

    Contains 2 DRADA repeats.
  • Information by UniProt

Images

  • ab153528 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153528 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153528.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up