Recombinant Human DAND5 protein (ab165848)

Description

  • Product name

    Recombinant Human DAND5 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDP TPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPK
    • Amino acids

      90 to 188
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BMP antagonist 3
    • CER2
    • cerberus 2
    • Cerberus like 2
    • Cerberus-like protein 2
    • Cerl-2
    • CERL2
    • CKTSF1B3
    • COCO
    • CRL2
    • Cysteine knot superfamily 1
    • Cysteine knot superfamily 1 BMP antagonist 3
    • DAN domain family member 5
    • Dand5
    • DAND5_HUMAN
    • DANTE
    • GREM3
    • Gremlin-3
    • MGC126849
    • SP1
    see all
  • Function

    Seems to play a role in the correct specification of the left-right axis. May antagonize NODAL and BMP4 signaling. Cystine knot-containing proteins play important roles during development, organogenesis, tissue growth and differentiation.
  • Sequence similarities

    Belongs to the DAN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab165848 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165848 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up