Description

  • Product name

    Recombinant Human DANGER protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAMGLFRVCLVVVTAIINHPLLFPRENATVPENEEEIIRKMQAHQEKLQL EQLRLEEEVARLAAEKEALEQVAEEGRQQNETRVAWDLWSTLCMILFLMI EVWRQDHQEGPSPECLGGEEDELPGLGGAPLQGLTLPNKATLGHFYERCI RGATADAARTREFLEGFVDDLLEALRSLCNRDTDMEVEDFIGVDSMYENW QVDRPLLCHLFVPFTPPEPYRFHPELWCSGRSVPLDRQGYGQIKVVRADG DTLSCICGKTKLGEDMLCLLHGRNSMAPPCGDMENLLCATDSLYLDTMQV MKWFQTALTRAWKGIAHKYEFDLAFGQLDSPGSLKIKFRSGKFMPFNLIP VIQCDDSDLYFVSHLPREPSEGTPASSTDWLLSFAVYERHFLRTTLKALP EGACHLSCLQIASFLLSKQSRLTGPSGLSSYHLKTALLHLLLLRQAADWK AGQLDARLHELLCFLEKSLLQKKLHHFFIGNRKVPEAMGLPEAVLRAEPL NLFRPFVLQRSLYRKTLDSFYEMLKNAPALISEYSLHVPSDQPTPKS
    • Amino acids

      1 to 547
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164760 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as ITPRIP. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BA127L20
    • BA127L20.2
    • DANGER
    • Inositol 1,4,5 triphosphate receptor- interacting protein
    • ITPRIP
    • KIAA1754
    • OTTHUMP00000020437
    • OTTHUMP00000020438
    • OTTHUMP00000020439
    • Protein DANGER
    • RP11-127L20.4
    see all
  • Relevance

    This protein enhances Ca2+-mediated inhibition of inositol-1,4,5-triphosphate receptor (ITPR) Ca2+ release. It is detected in brain where it is concentrated in cerebellar Purkinje cells (at protein level).
  • Cellular localization

    Cell Membrane

Images

  • ab164760 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164760 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164760.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up