Overview

  • Product name

    Recombinant Human DAP13/NDUFA12 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYE DNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTT KPLAARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK
    • Amino acids

      1 to 145
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as DAP13

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 13 kDa differentiation associated protein
    • 13 kDa differentiation-associated protein
    • 2410011G03Rik
    • AW112974
    • B17.2
    • CI-B17.2
    • CIB17.2
    • Complex I B17.2
    • Complex I B17.2 subunit
    • Complex I-B17.2
    • DAP13
    • MGC107642
    • MGC7999
    • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 12
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
    • NADH ubiquinone oxidoreductase subunit B17.2
    • NADH-ubiquinone oxidoreductase subunit B17.2
    • NDUAC_HUMAN
    • NDUFA12
    • RGD1311462
    see all
  • Function

    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Involvement in disease

    Defects in NDUFA12 are the cause of Leigh syndrome (LS) [MIM:256000]. An early-onset progressive neurodegenerative disorder characterized by the presence of focal, bilateral lesions in one or more areas of the central nervous system including the brainstem, thalamus, basal ganglia, cerebellum and spinal cord. Clinical features depend on which areas of the central nervous system are involved and include subacute onset of psychomotor retardation, hypotonia, ataxia, weakness, vision loss, eye movement abnormalities, seizures, and dysphagia.
  • Sequence similarities

    Belongs to the complex I NDUFA12 subunit family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab163283 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163283.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up