Overview

  • Product name

    Recombinant Human DAP3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MMLKGITRLISRIHKLDPGRFLHMGTQARQSIAAHLDNQVPVESPRAISR TNENDPAKHGDQHEGQHYNISPQDLETVFPHGLPPRFVMQVKTFSEACLM VRKPALELLHYLKNTSFAYPAIRYLLYGEKGTGKTLSLCHVIHFCAKQDW LILHIPDAHLWVKNCRDLLQSSYNKQRFDQPLEASTWLKNFKTTNERFLN QIKVQEKYVWNKRESTEKGSPLGEVVEQGITRVRNATDAVGIVLKELKRQ SSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKND WHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNP KEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPSLLERHCAYL
    • Molecular weight

      69 kDa including tags
    • Amino acids

      1 to 398

Specifications

Our Abpromise guarantee covers the use of ab131869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 28S ribosomal protein S29
    • 28S ribosomal protein S29 mitochondrial
    • bMRP10
    • DAP 3
    • DAP-3
    • Dap3
    • Death associated protein 3
    • Death-associated protein 3
    • DKFZp686G12159
    • FLJ12817
    • Ionizing radiation resistance conferring protein
    • MGC126058
    • MGC126059
    • mitochondrial
    • Mitochondrial 28S ribosomal protein S29
    • MITOCHONDRIAL RIBOSOMAL PROTEIN S29
    • MRP S29
    • MRP-S29
    • MRPS29
    • OTTHUMP00000033480
    • OTTHUMP00000033481
    • PSD-95/SAP90-binding protein 3
    • RT29_HUMAN
    • S29mt
    • SAP90/PSD-95-associated protein 3
    • SAPAP3
    see all
  • Function

    Involved in mediating interferon-gamma-induced cell death.
  • Tissue specificity

    Ubiquitous.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131869 stained with Coomassie Blue.

References

ab131869 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up