Overview

  • Product name
    Recombinant Human DAP5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEI IEEEAFLAWKEDITQEFPGKGKALFQVNQ
    • Amino acids
      811 to 889
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158342 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DAP-5
    • Death associated protein 5
    • Death-associated protein 5
    • eIF-4-gamma 2
    • eIF-4G 2
    • eIF4G 2
    • EIF4G2
    • Eukaryotic translation initiation factor 4 gamma 2
    • IF4G2_HUMAN
    • Nat1
    • Novel APOBEC-1 target 1
    • p97
    • Translation repressor NAT1
    see all
  • Function
    Appears to play a role in the switch from cap-dependent to IRES-mediated translation during mitosis, apoptosis and viral infection. Cleaved by some caspases and viral proteases.
  • Tissue specificity
    Ubiquitously expressed in all adult tissues examined, with high levels in skeletal muscle and heart. Also expressed in fetal brain, lung, liver and kidney.
  • Sequence similarities
    Belongs to the eIF4G family.
    Contains 1 MI domain.
    Contains 1 MIF4G domain.
    Contains 1 W2 domain.
  • Post-translational
    modifications
    Phosphorylation; hyperphosphorylated during mitosis.
  • Information by UniProt

Images

  • ab158342 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158342 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158342.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up