Description

  • Product name

    Recombinant Human DBC1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNWRFVGLLYFLFIWGRISVQPSHQEPAGTDQHVSKEFDWLISDRGPFHH SRSYLSFVERHRQGFTTRYKIYREFARWKVRNTAIERRDLVRHPVPLMPE FQRSIRLLGRRPTTQQFIDTIIKKYGTHLLISATLGGEEALTMYMDKSRL DRKSGNATQSVEALHQLASSYFVDRDGTMRRLHEIQISTGAIKVTETRTG PLGCNSYDNLDSVSSVLLQSTESKLHLQGLQIIFPQYLQEKFVQSALSYI MCNGEGEYLCQNSQCRCQCAEEFPQCNCPITDIQIMEYTLANMAKSWAEA YKDLENSGRESHSVPLHEWP
    • Predicted molecular weight

      61 kDa including tags
    • Amino acids

      1 to 320

Specifications

Our Abpromise guarantee covers the use of ab132860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BMP/retinoic acid-inducible neural-specific protein 1
    • BRINP1
    • DBC1
    • DBC1_HUMAN
    • DBCCR1
    • Deleted in bladder cancer protein 1
    • Deleted in bladder cancer protein 1 precursor
    • FAM5A
    • IB3089A
    • Protein FAM5A
    see all
  • Function

    Inhibits cell proliferation by negative regulation of the G1/S transition. Mediates cell death which is not of the classical apoptotic type and regulates expression of components of the plasminogen pathway.
  • Tissue specificity

    Highly expressed in brain. Weakly expressed in heart, lung, skeletal muscle, kidney, thymus, prostate, testis and small intestine.
  • Sequence similarities

    Belongs to the FAM5 family.
    Contains 1 MACPF domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132860 stained with Coomassie Blue.

References

ab132860 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up