Overview

  • Product name

    Recombinant Human DBR1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRVAVAGCCHGELDKIYETLALAERRGPGPVDLLLCCGDFQAVRNEADLR CMAVPPKYRHMQTFYRYYSGEKKAPVLTLFIGGNHEASNHLQELPYGGWV APNIYYLGLAGVVKYRGVRIGGISGIFKSHDYRKGHFECPPYNSSTIRSI YHVRNIEVYKLKQLKQPIDIFLSHDWPRSIYHYGNKKQLLKTKSFFRQEV ENNTLGSPAASELLEHLKPTYWFSAHLHVKFAALMQHQAKDKGQTARATK FLALDKCLPHRDFLQILEIEHDPSAPDYLEYDIEWLTILRATDDLINVTG RLWNMPENNGLHARWDYSATEEGMKEVLEKLNHDLKVPCNFSVTAACYDP SKPQTQMQLIHRINPQTTEFCAQLGIIDINVRLQKSKEEHHVCGEYEEQD DVESNDSGEDQSEYNTDTSALSSINPDEIMLDEEEDEDSIVSAHSGMNTP SVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESG NGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDDDDDDAA
    • Molecular weight

      88 kDa including tags
    • Amino acids

      1 to 544

Specifications

Our Abpromise guarantee covers the use of ab132751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DBR1
    • DBR1_HUMAN
    • Debranching enzyme homolog 1 (S. cerevisiae)
    • Lariat debranching enzyme
    • RNA lariat debranching enzyme
    see all
  • Function

    Cleaves the 2'-5' phosphodiester linkage at the branch point of lariat intron pre-mRNAs after splicing and converts them into linear molecules that are subsequently degraded. It thereby facilitates ribonucleotide turnover. It may also participate in retrovirus replication via a RNA lariat intermediate in cDNA synthesis.
  • Sequence similarities

    Belongs to the lariat debranching enzyme family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab132751 on 12.5% SDS-PAGE stained with Coomassie blue.

References

ab132751 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132751.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up