Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSF TLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEI YQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQEL TWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLK AAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVE RLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQ NFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNN VGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPN PPPA
    • Molecular weight

      72 kDa including tags
    • Amino acids

      1 to 404
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab131780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C type lectin domain family 4 member L
    • C-type lectin domain family 4 member L
    • CD 209
    • CD209
    • CD209 antigen
    • CD209 antigen-like protein A
    • CD209 molecule
    • CD209_HUMAN
    • Cd209a
    • CDSIGN
    • CIRE
    • CLEC4L
    • DC SIGN
    • DC SIGN1
    • DC-SIGN
    • DC-SIGN1
    • DCSIGN
    • Dendritic cell specific ICAM 3 grabbing nonintegrin 1
    • Dendritic cell specific ICAM3 grabbing nonintegrin 1
    • Dendritic cell-specific ICAM-3-grabbing non-integrin 1
    • Dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin
    • Dengue fever, protection against, included
    • Dentritic Cell Specific ICAM3 Grabbing Nonintegrin
    • HIV GP120 Binding Protein
    • MGC129965
    • MGC130443
    • SIGN-R1
    • SIGNR5
    see all
  • Function

    Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response. Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens, including HIV-1 gp120, HIV-2 gp120, SIV gp120, ebolavirus glycoproteins, cytomegalovirus gB, HCV E2, dengue virus gE, Leishmania pifanoi LPG, Lewis-x antigen in Helicobacter pylori LPS, mannose in Klebsiella pneumonae LPS, di-mannose and tri-mannose in Mycobacterium tuberculosis ManLAM and Lewis-x antigen in Schistosoma mansoni SEA.
    On DCs it is a high affinity receptor for ICAM2 and ICAM3 by binding to mannose-like carbohydrates. May act as a DC rolling receptor that mediates transendothelial migration of DC presursors from blood to tissues by binding endothelial ICAM2. Seems to regulate DC-induced T-cell proliferation by binding to ICAM3 on T-cells in the immunological synapse formed between DC and T-cells.
  • Tissue specificity

    Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Domain

    The tandem repeat domain, also called neck domain, mediates oligomerization.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131780 stained with Coomassie Blue.

References

ab131780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up