Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDH GFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM
    • Amino acids
      640 to 729
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Calcium/calmodulin-dependent protein kinase type I-like CPG16
    • CL1
    • CLICK1
    • Cpg16
    • DCDC3A
    • Dcl
    • Dclk
    • Dclk1
    • DCLK1_HUMAN
    • Doublecortin domain-containing protein 3A
    • Doublecortin-like and CAM kinase-like 1
    • Doublecortin-like kinase 1
    • KIAA0369
    • Serine/threonine-protein kinase DCAMKL1
    • Serine/threonine-protein kinase DCLK1
    see all
  • Function
    Probable kinase that may be involved in a calcium-signaling pathway controlling neuronal migration in the developing brain. May also participate in functions of the mature nervous system.
  • Tissue specificity
    In fetal tissues, highly expressed in brain, detectable in lung and liver, but not in kidney. In adult tissues, expressed ubiquitously in the brain, detectable in the heart, liver, spleen, thymus, prostate, testis, ovary, small intestine and colon. The type A isoforms seem to be expressed predominantly in fetal brain whereas type B isoforms are expressed abundantly in both fetal and adult brain.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily.
    Contains 2 doublecortin domains.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab160376 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160376 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up