Overview

  • Product name
    Recombinant Human DCBLD2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFN YLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNE
    • Amino acids
      80 to 164
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1700055P21Rik
    • AW146002
    • CLCP1
    • coagulation factor V/VIII-homology domains protein 1
    • CUB
    • CUB and LCCL domain-containing protein 2
    • CUB, LCCL and coagulation factor V/VIII-homology domains protein 1
    • DCBD2_HUMAN
    • DCBLD2
    • Discoidin
    • discoidin CUB and LCCL domain containing 2
    • Discoidin, CUB and LCCL domain-containing protein 2
    • Endothelial and smooth muscle cell-derived neuropilin-like protein
    • ESDN
    • LCCL and coagulation factor V/VIII-homology domains protein 1
    see all
  • Tissue specificity
    Highly expressed in testis, heart, skeletal muscle and also in cultured vascular smooth muscle cells.
  • Sequence similarities
    Contains 1 CUB domain.
    Contains 1 F5/8 type C domain.
    Contains 1 LCCL domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab165349 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165349 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up