Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSFGSQRVLVEPDAGAGVAVMKFKNPPVN SLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTEMCGRSP AHYAGYWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILAD NPRYCIGLNETQLGIIAPFWLKDTLENTIGHRAAERALQLGLLFPPAEAL QVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMRKATASRLVT QRDADVQNFVSFISKDSIQKSLQMYLERLKEEKG
    • Molecular weight
      31 kDa including tags
    • Amino acids
      42 to 302
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Mature form (without transit peptide). NP_001910

Specifications

Our Abpromise guarantee covers the use of ab174405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • 2-trans-enoyl-CoA isomerase
    • 3
    • 3,2 trans enoyl Coenzyme A isomerase
    • 3,2 trans-enoyl-CoA isomerase
    • 3,2-trans-enoyl-CoA isomerase, mitochondrial
    • Acetylene allene isomerase
    • D2-enoyl-CoA isomerase
    • D3
    • D3,D2 enoyl CoA isomerase
    • DCI
    • DCI protein
    • delta(2)-enoyl-CoA isomerase
    • Delta(3)
    • Delta(3),Delta(2) enoyl CoA isomerase
    • Delta3, delta2 enoyl CoA isomerase
    • Dodecenoyl CoA delta Isomerase
    • Dodecenoyl CoA isomerase
    • Dodecenoyl Coenzyme A delta isomerase
    • Dodecenoyl Coenzyme A delta isomerase (3,2 trans enoyl Coenzyme A isomerase)
    • Dodecenoyl Coenzyme A delta isomerase 3,2 trans enoyl Coenzyme A isomerase, isoform CRA a
    • Dodecenoyl-CoA isomerase
    • ECI1
    • ECI1_HUMAN
    • Enoyl-CoA delta isomerase 1
    • enoyl-CoA delta isomerase 1, mitochondrial
    • mitochondrial
    see all
  • Function
    Able to isomerize both 3-cis and 3-trans double bonds into the 2-trans form in a range of enoyl-CoA species.
  • Pathway
    Lipid metabolism; fatty acid beta-oxidation.
  • Sequence similarities
    Belongs to the enoyl-CoA hydratase/isomerase family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174405 at 3μg.

References

ab174405 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up