Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDI EGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNA SLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCS DHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEE MPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDAS QKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASIT QSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPR QRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRL TPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASA SLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSV LLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDT LIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL
    • Amino acids
      1 to 582
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163233 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DCP1 decapping enzyme homolog A
    • Dcp1a
    • DCP1A_HUMAN
    • Decapping enzyme hDcp1a
    • Decapping mRNA 1A
    • HSA275986
    • mRNA decapping enzyme 1A
    • mRNA-decapping enzyme 1A
    • Nbla00360
    • Putative protein product of Nbla00360
    • Smad4 interacting transcriptional co activator
    • Smad4-interacting transcriptional co-activator
    • Smad4-interacting transcriptional co-activator
    • SMAD4IP1
    • SMIF
    • Transcription factor SMIF
    see all
  • Function
    Necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Contributes to the transactivation of target genes after stimulation by TGFB1.
  • Tissue specificity
    Detected in heart, brain, placenta, lung, skeletal muscle, liver, kidney and pancreas.
  • Sequence similarities
    Belongs to the DCP1 family.
  • Cellular localization
    Cytoplasm > P-body. Nucleus. Co-localizes with NANOS3 in the processing bodies (By similarity). Predominantly cytoplasmic, in processing bodies (PB). Nuclear, after TGFB1 treatment. Translocation to the nucleus depends on interaction with SMAD4.
  • Information by UniProt

Images

  • ab163233 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163233 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163233.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up