Description

  • Product name

    Recombinant Human DcR1 protein
    See all DcR1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab151632 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDY TNASNNEPSC FPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGE VQVSNCTSWD DIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAE ETMTTSPGTP APAAEETMTTSPGTPAVDHHHHHH
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      26 to 221
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Constituents: 99.2% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • Antagonist decoy receptor for TRAIL/Apo 2L
    • CD263
    • Cytotoxic TRAIL receptor 3
    • DCR1
    • DCR1 TNFR
    • Decoy Receptor 1
    • Decoy TRAIL receptor without death domain
    • LIT
    • Lymphocyte inhibitor of TRAIL
    • MGC149501
    • MGC149502
    • TNF related apoptosis inducing ligand receptor 3
    • TNF-re ated apoptosis inducing ligand receptor 3
    • TNFRSF10C
    • TRAIL R3
    • TRAIL receptor 3
    • TRAILR3
    • TRID
    • Tumor necrosis factor receptor superfamily member 10C
    • Tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
    see all
  • Relevance

    DcR1 / TRAIL-R3 / TRID / LIT is one of the two putative decoy receptors identified for TRAIL, one of the members of TNF family of apoptosis inducing proteins. The other putative decoy receptor is called DcR2 / TRUNDD / TRAIL-R4. DcR1 is attached to the cell surface through glycophospholipid anchor. It has the extracellular TRAIL binding domain but lacks the cytoplasmic domain to induce apoptotic signal. Hence overexpression of DcR1 inhibits the TRAIL induced apoptosis.
  • Cellular localization

    Cell Membrane and Cytoplasmic

References

ab151632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up