Description

  • Product name

    Recombinant Human DcR2 protein (Fc Chimera)
    See all DcR2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDY TIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMC RTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGM LASPYH
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      56 to 211
    • Additional sequence information

      Extracellular domain fused with a human IgG1 Fc tag at the C-terminus (NP_003831).

Specifications

Our Abpromise guarantee covers the use of ab220593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, Sodium chloride, L-Arginine

    Lyophilized from 0.22 µm filtered solution.
    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD 264
    • CD264
    • DcR 2
    • DcR2
    • Decoy receptor 2
    • Decoy with truncated death domain
    • OTTHUMP00000123528
    • TNF receptor related receptor for TRAIL
    • TNF related apoptosis inducing ligand receptor 4
    • TNF-related apoptosis-inducing ligand receptor 4
    • TNFRSF 10D
    • TNFRSF10D
    • TR10D_HUMAN
    • TRAIL R4
    • TRAIL receptor 4
    • TRAIL receptor with a truncated death domain
    • TRAIL-R4
    • TRAILR4
    • TRUNDD
    • Tumor necrosis factor receptor superfamily member 10D
    • Tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
    see all
  • Function

    Receptor for the cytotoxic ligand TRAIL. Contains a truncated death domain and hence is not capable of inducing apoptosis but protects against TRAIL-mediated apoptosis. Reports are contradictory with regards to its ability to induce the NF-kappa-B pathway. According to PubMed:9382840, it cannot but according to PubMed:9430226, it can induce the NF-kappa-B pathway.
  • Tissue specificity

    Widely expressed, in particular in fetal kidney, lung and liver, and in adult testis and liver. Also expressed in peripheral blood leukocytes, colon and small intestine, ovary, prostate, thymus, spleen, pancreas, kidney, lung, placenta and heart.
  • Sequence similarities

    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab220593 stained overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 50-66 kDa in SDS-PAGE due to glycosylation.

References

ab220593 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up