Overview

  • Product name

    Recombinant Human DCTN3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSK RERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVAL LEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGS LVEDVGFAQFLSVLHFGPTGPVCGNH
    • Amino acids

      1 to 176
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161382 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DCNT22
    • DCTN 22
    • DCTN22
    • Dctn3
    • DCTN3_HUMAN
    • dynactin 3
    • dynactin 3 (p22)
    • dynactin 3 isoform 1
    • Dynactin complex subunit 22 kDa subunit
    • dynactin light chain
    • Dynactin subunit 3
    • p22
    see all
  • Function

    Together with dynein may be involved in spindle assembly and cytokinesis.
  • Tissue specificity

    Ubiquitously expressed. Highly expressed in muscle and pancreas and detected at lower levels in brain.
  • Sequence similarities

    Belongs to the dynactin subunit 3 family.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton > centrosome. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > spindle. Cleavage furrow. Midbody. Localizes to punctate cytoplasmic structures and to the centrosome during interphase, and to kinetochores and to spindle poles throughout mitosis. Colocalizes with dynein to the cleavage furrow and to midbody of dividing cells.
  • Information by UniProt

Images

  • ab161382 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161382 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161382.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up