Description

  • Product name

    Recombinant Human DCTN5 protein
  • Purity

    > 90 % SDS-PAGE.
    The final product was refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGEFMELGELLYNKSEYIETASGNKVSRQSVLCGSQNIV LNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPL HIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLP PETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      1 to 182
    • Tags

      T7 tag N-Terminus
    • Additional sequence information

      NP_115875.

Specifications

Our Abpromise guarantee covers the use of ab182817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names

    • DCTN 5
    • DCTN5
    • DCTN5_HUMAN
    • Dynactin 4
    • Dynactin 5 (p25)
    • Dynactin subunit 5
    • Dynactin subunit p25
    • p25
    see all
  • Sequence similarities

    Belongs to the dynactin subunits 5/6 family. Dynactin subunit 5 subfamily.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

References

ab182817 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182817.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up