Description

  • Product name

    Recombinant Human DCTN6/WS3 protein
  • Purity

    > 85 % SDS-PAGE.
    ab187478 was purified by conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAEKTQKSVKIAPGAVVCVESEIRGDV TIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNITPDTEDP EPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGA CCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHL KKTMKGSSTPVKN
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      1 to 190
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab187478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as DCTN6

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • DCTN6
    • DCTN6_HUMAN
    • Dynactin 6
    • Dynactin subunit 6
    • Dynactin subunit p27
    • Novel RGD containing protein
    • p27
    • Protein WS-3
    • Protein WS3
    • WS 3
    • WS3
    see all
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the dynactin subunits 5/6 family. Dynactin subunit 6 subfamily.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 15% SDS-PAGE using 3μg ab187478.

References

ab187478 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up