Description

  • Product name

    Recombinant Human DCUN1D3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGQCVTKCKNPSSTLGSKNGDREPSNKSHSRRGAGHREEQVPPCGKPGGD ILVNGTKKAEAATEACQLPTSSGDAGRESKSNAEESSLQRLEELFRRYKD EREDAILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMCKFTRKEFFDG CKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSL HREIAIALWKLVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFT QVIGPDLSNYSEDEAWPSLFDTFVEWEMERRKREGEGRGALSSGPEGLCP EEQT
    • Amino acids

      1 to 304
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165201 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 44M2.4
    • DCN1 defective in cullin neddylation 1 domain containing 3
    • DCN1 defective in cullin neddylation 1 domain containing 3 (S. cerevisiae)
    • DCN1 like protein 3
    • DCN1-like protein 3
    • DCNL3_HUMAN
    • DCUN1 domain containing protein 3
    • DCUN1 domain-containing protein 3
    • dcun1d3
    • Defective in cullin neddylation protein 1 like protein 3
    • Defective in cullin neddylation protein 1-like protein 3
    • DKFZp686O0290
    • FLJ41725
    • MGC48972
    • Squamous cell carcinoma-related oncogene 3
    see all
  • Function

    Antagonizes DCUN1D1-mediated CUL1 neddylation by sequestering CUL1 at the cell membrane (PubMed:25349211). When overexpressed in transformed cells, may promote mesenchymal to epithelial-like changes and inhibit colony formation in soft agar (PubMed:25349211).
  • Tissue specificity

    Tends to be down-regulated in different type of cancers, including lung neuroendocrine carcinoma, thyroid Huerthle cell carcinoma and lung squamous cell carcinoma.
  • Sequence similarities

    Contains 1 DCUN1 domain.
  • Domain

    The DCUN1 domain, also known as PONY domain, mediates recognition of the N-terminally acetylated NEDD8-conjugating E2 enzyme. This domain is also involved in CAND1-, CUL1-, CUL3- and RBX1-binding.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab165201 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165201 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165201.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up