Description

  • Product name

    Recombinant Human DCXR protein
    See all DCXR proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab98147 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMELFLAGRRVLVTGAGKGIGRGTVQALHAT GARVVAVSRTQADLDSLVRECPGIEPVCVDLGDWEATERALGSVGPVDLL VNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGA IVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPT VVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMT TGSTLPVEGGFWAC
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      1 to 244
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names

    • Carbonyl reductase 2
    • Carbonyl reductase II
    • DCR
    • Dcxr
    • DCXR_HUMAN
    • Dicarbonyl and L xylulose reductase
    • Dicarbonyl L xylulose reductase
    • Dicarbonyl/ L xylulose reductase
    • Dicarbonyl/L-xylulose reductase
    • HCR2
    • HCRII
    • Human carbonyl reductase 2
    • kiDCR
    • Kidney dicarbonyl reductase
    • L xylulose reductase
    • L-xylulose reductase
    • P34H
    • PNTSU
    • SDR20C1
    • Short chain dehydrogenase/reductase family 20C member 1
    • Sperm surface protein P34H
    • XR
    see all
  • Function

    Catalyzes the NADPH-dependent reduction of several pentoses, tetroses, trioses, alpha-dicarbonyl compounds and L-xylulose. Participates in the uronate cycle of glucose metabolism. May play a role in the water absorption and cellular osmoregulation in the proximal renal tubules by producing xylitol, an osmolyte, thereby preventing osmolytic stress from occurring in the renal tubules.
  • Tissue specificity

    Highly expressed in kidney, liver and epididymis. In the epididymis, it is mainly expressed in the proximal and distal sections of the corpus region. Weakly or not expressed in brain, lung, heart, spleen and testis.
  • Involvement in disease

    Note=The enzyme defect in pentosuria has been shown to involve L-xylulose reductase. Essential pentosuria is an inborn error of metabolism characterized by the excessive urinary excretion of the pentose L-xylulose.
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization

    Membrane. Probably recruited to membranes via an interaction with phosphatidylinositol.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab98147

References

ab98147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up