For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-ddah1-protein-ab99863.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurotransmission Nitric Oxide NOS
Share by email

Recombinant Human DDAH1 protein (ab99863)

  • Datasheet
Submit a review Q&A (3)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human DDAH1 protein (ab99863)
  • Western blot - Recombinant Human DDAH1 protein (ab99863)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 95% SDS-PAGE
  • Tags: His tag N-Terminus
  • Suitable for: WB, SDS-PAGE, MS

Description

  • Product name

    Recombinant Human DDAH1 protein
  • Purity

    > 95 % SDS-PAGE.
    ab99863 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

    O94760
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAGLGHPAAFGRATHAVVRALPESLGQ HALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADESLPDCVFV EDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLD GGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSF CSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNI PNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSV LINKKVDS
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      1 to 285
    • Tags

      His tag N-Terminus

Associated products

  • Related Products

    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-DDAH1 antibody (ab2231)
    • Anti-6X His tag® antibody [4D11] (ab5000)

Specifications

Our Abpromise guarantee covers the use of ab99863 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.29% Sodium chloride

General Info

  • Alternative names

    • DDAH
    • DDAH I
    • DDAH-1
    • DDAH1
    • DDAH1_HUMAN
    • DDAHI
    • Dimethylargininase 1
    • Dimethylargininase-1
    • Dimethylarginine dimethylaminohydrolase 1
    • N(G)
    • N(G)-dimethylarginine dimethylaminohydrolase 1
    • NG NG dimethylarginine dimethylaminohydrolase
    see all
  • Function

    Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
  • Tissue specificity

    Detected in brain, liver, kidney and pancreas, and at low levels in skeletal muscle.
  • Sequence similarities

    Belongs to the DDAH family.
  • Target information above from: UniProt accession O94760 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human DDAH1 protein (ab99863)
    SDS-PAGE - Recombinant Human DDAH1 protein (ab99863)
    15% SDS-PAGE showing ab99863 (3µg).
  • Western blot - Recombinant Human DDAH1 protein (ab99863)
    Western blot - Recombinant Human DDAH1 protein (ab99863)

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab99863? Please let us know so that we can cite the reference in this datasheet.

    ab99863 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-3 of 3 Abreviews or Q&A

    Question

    Please see customers response below:

    I am also looking for recombinant protein to use as positive control in western blot for eNOS/NOS3, eNOS/NOS3 phosphorylated on serine 1177, DDAH1 and DDAH2.

    The western blot will be done in denaturing conditions

    - For eNOS protein, my antibody recognise a C-terminal sequence of the protein

    - DDAH1 my antibody recognise a sequence between the amino acid 198 to 237 of the protein

    - DDAH2 my antibody recognise a N-terminal sequence of the protein

    Hope this helps.

    Thanks

    Kind regards,

    Read More

    Abcam community

    Verified customer

    Asked on Jul 18 2012

    Answer

    Thank you for your response.

    I have conducted a search for your customer and found the following products in our catalogue.

    ab109090: eNOS/NOS3 - C terminal peptide, though it has not been tested in Western blot application; it was the immunogne peptide for ab95254 antibody.

    Currently, we do not have eNOS/NOS3 phosphorylated on serine 1177.

    ab99863: DDAH1 - Recombinant full length Human DDAH1 (amino acids 1-285) with an N terminal His tag; 308 amino acids with a predicted MWt 33.5kDa including tag.

    ab92017: DDAH2 - Recombinant fragment, corresponding to amino acids 71-261 (191 amino acids) of Human DDAH2 with N terminal His tag.

    Could you please advise your customer to read the product datasheets carefully to decide if any of them would suit his/her need.

    I hope this helps and if I can assist further, please do not hesitate to contact me.

    Read More

    Abcam Scientific Support

    Answered on Jul 18 2012

    Question

    Dear Supplier,

    We have a customer who is interested ab99863, DDAH1 protein. Please see their inquiry below:

    Recombinant protein with a GST-tag/his-tag, are they good positive control ?

    The protein is longer with the tag so the molecular weight is higher and the migration of the protein will be different than the migration of the non-tagged protein, the tag will not affect the recognition of the protein by the antibody so I think I can use it as a positive control. could you confirm that ?

    Your help will be much appreciated.

    Kind regards,

    Read More

    Abcam community

    Verified customer

    Asked on Jul 17 2012

    Answer

    Thank you for your enquiry and interest in our products.

    It depends on some factors such as the position of the tag, the number of copies, the clonality of the antibody etc. It would be also interesting to know in what application the customer would like to use the DDAH1 protein.

    Let me know if you have any further questions.

    Read More

    Abcam Scientific Support

    Answered on Jul 17 2012

    Question

    We have a customer who is looking for recombinant protein to use as positive control in western blot for eNOS/NOS3, eNOS/NOS3 phosphorylated on serine 1177, DDAH1 and DDAH2. Do you have this product?

    Read More

    Abcam community

    Verified customer

    Asked on Jul 04 2012

    Answer

    Thank you for contacting us.

    We have:

    DDAH1 protein (https://www.abcam.com/ab99863), Recombinant full length Human DDAH1 (amino acids 1-285) with an N terminal His tag.
    DDAH2 protein (Tagged-His Tag) (https://www.abcam.com/ab92017), Recombinant fragment, corresponding to amino acids 71-261 (191 amino acids) of Human DDAH2 with N terminal His tag.



    For eNOS, the only 2 products we have are:

    The protein fragment https://www.abcam.com/ab112329, corresponding to amino acids 61-160 of Human eNOS with a proprietary tag.
    The peptide https://www.abcam.com/ab109090, immunogen for ab95254.



    The 2 eNOS products are not phosphorylated.


    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Read More

    Abcam Scientific Support

    Answered on Jul 04 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.