Description

  • Product name

    Recombinant Human DDHD2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSSVQSQQEQLSQSDPSPSPNSCSSFELIDMDAGSLYEPVSPHWFYCKII DSKETWIPFNSEDSQQLEEAYSSGKGCNGRVVPTDGGRYDVHLGERMRYA VYWDELASEVRRCTWFYKGDKDNKYVPYSESFSQVLEETYMLAVTLDEWK KKLESPNREIIILHNPKLMVHYQPVAGSDDWGSTPTEQGRPRTVKRGVEN ISVDIHCGEPLQIDHLVFVVHGIGPACDLRFRSIVQCVNDFRSVSLNLLQ THFKKAQENQQIGRVEFLPVNWHSPLHSTGVDVDLQRITLPSINRLRHFT NDTILDVFFYNSPTYCQTIVDTVASEMNRIYTLFLQRNPDFKGGVSIAGH SLGSLILFDILTNQKDSLGDIDSEKDSLNIVMDQGDTPTLEEDLKKLQLS EFFDIFEKEKVDKEALALCTDRDLQEIGIPLGPRKKILNYFSTRKNSMGI KRPAPQPASGANIPKESEFCSSSNTRNGDYLDVGIGQVSVKYPRLIYKPE IFFAFGSPIGMFLTVRGLKRIDPNYRFPTCKGFFNIYHPFDPVAYRIEPM VVPGVEFEPMLIPHHKGRKRMHLELREGLTRMSMDLKNNLLGSLRMAWKS FTRAPYPALQASETPEETEAEPESTSEKPSDVNTEETSVAVKEEVLPINV GMLNGGQRIDYVLQEKPIESFNEYLFALQSHLCYWESEDTVLLVLKEIYQ TQGIFLDQPLQ
    • Amino acids

      1 to 711
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161583 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DDHD domain containing protein 2
    • DDHD domain-containing protein 2
    • Ddhd2
    • DDHD2_HUMAN
    • KIAA0725
    • mKIAA0725
    • Phospholipase DDHD2
    • SAM
    • SAM, WWE and DDHD domain containing protein 1
    • SAMWD1
    • WWE and DDHD domain-containing protein 1
    see all
  • Function

    Phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine. May be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.
  • Tissue specificity

    Ubiquitously expressed (at protein level).
  • Sequence similarities

    Belongs to the PA-PLA1 family.
    Contains 1 DDHD domain.
    Contains 1 SAM (sterile alpha motif) domain.
    Contains 1 WWE domain.
  • Cellular localization

    Cytoplasm. Cytoplasmic granule.
  • Information by UniProt

Images

  • ab161583 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161583 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161583.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up