Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFE ESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEP CGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSF RDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS
    • Amino acids
      1 to 193
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DNA damage inducible transcript 4 like
    • DNA damage inducible transcript 4 like protein
    • HIF 1 responsive protein RTP801 like
    • Homolog of mouse SMHS1
    • Protein regulated in development and DNA damage response 2
    • Protein regulated in development and DNA damage responses 2
    • REDD 2
    • REDD2
    • Regulated in development and DNA damage response 2
    • RTP801L
    see all
  • Relevance
    DDIT4L inhibits cell growth by regulating the FRAP1 pathway upstream of the TSC1-TSC2 complex and downstream of AKT1. It is up regulated in atherosclerotic plaques relative to healthy segments of the same artery.
  • Cellular localization
    Cytoplasmic

Images

  • ab165065 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up