Overview

  • Product name

    Recombinant Human DDOST protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGYFRCAGAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGPRTLVL LDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIF SPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFD EEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGV GMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQAR NNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVF KEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDG DDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYT HLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMK EKEKSD
    • Molecular weight

      77 kDa including tags
    • Amino acids

      1 to 456

Specifications

Our Abpromise guarantee covers the use of ab132709 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Advanced glycation endproduct receptor 1
    • AGE R1
    • AGER1
    • CDG1R
    • DDOST 48 kDa subunit
    • Dolichyl diphosphooligosaccharide protein glycosyltransferase subunit (non catalytic)
    • Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
    • Dolichyl-diphosphooligosaccharide-protein glycosyltransferase
    • EC 2.4.1.119
    • KIAA0115
    • MGC2191
    • OK/SW-cl.45
    • OKSWcl45
    • Oligosaccharyl transferase 48 kDa subunit
    • Oligosaccharyltransferase
    • Oligosaccharyltransferase 48 kDa subunit
    • Oligosaccharyltransferase subunit 48
    • OST
    • OST48
    • RP23-25C1.4
    • WBP1
    • wu:fa11d01
    • zgc:66068
    • zgc:77478
    see all
  • Relevance

    DDOST (Dolichyl-diphosphooligosaccharide-protein glycosyltransferase) is a component of the oligosaccharyltransferase complex. This complex catalyzes the transfer of high-mannose oligosaccharides to asparagine residues on nascent polypeptides in the lumen of the rough endoplasmic reticulum and co-purifies with ribosomes. DDOST is also implicated in the processing of advanced glycation endproducts (AGEs), which form from non-enzymatic reactions between sugars and proteins or lipids and are associated with aging and hyperglycemia.
  • Cellular localization

    Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Images

  • ab132709 analyzed by 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab132709 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132709.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up