Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      KAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDGA WCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKIN YSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTD HSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAV GYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEI MFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFP LVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMY NNSEALPTSPMAPTTYDPMLKVDDSNTRLEHHHHHH
    • Molecular weight

      44 kDa including tags
    • Amino acids

      22 to 400
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab222446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    ab222446 was purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • CD167 antigen-like family member B
    • CD167b
    • CD167b antigen
    • Cell migration inducing protein 20
    • DDR 2
    • DDR2
    • DDR2_HUMAN
    • Discoidin domain containing receptor 2
    • Discoidin domain receptor 2
    • Discoidin domain receptor family member 2
    • discoidin domain receptor tyrosine kinase 2
    • Discoidin domain-containing receptor 2
    • discoidin domain-containing receptor tyrosine kinase 2
    • Hydroxyaryl protein kinase
    • MIG20a
    • Migration inducing gene 16 protein
    • Neurotrophic tyrosine kinase
    • Neurotrophic tyrosine kinase receptor related 3
    • NTRKR 3
    • NTRKR3
    • Receptor protein tyrosine kinase TKT
    • Receptor protein-tyrosine kinase TKT
    • Receptor related 3
    • receptor-related 3
    • TKT
    • TYRO 10
    • TYRO10
    • Tyrosine kinase receptor related to neurotrophic TRK
    • Tyrosine protein kinase TYRO 10
    • Tyrosine protein kinase TYRO10
    • Tyrosine-protein kinase TYRO10
    • Tyrosylprotein kinase
    see all
  • Function

    This tyrosine kinase receptor for fibrillar collagen mediates fibroblast migration and proliferation. Contributes to cutaneous wound healing.
  • Tissue specificity

    The major 10 kDa transcript is expressed in high levels in heart and lung, less in brain, placenta, liver, skeletal muscle, pancreas, and kidney.
  • Involvement in disease

    Defects in DDR2 are the cause of spondyloepimetaphyseal dysplasia short limb-hand type (SEMD-SL) [MIM:271665]. A bone disease characterized by short-limbed dwarfism, a narrow chest with pectus excavatum, brachydactyly in the hands and feet, a characteristic craniofacial appearance and premature calcifications. The radiological findings are distinctive and comprise short long bones throughout the skeleton with striking epiphyses that are stippled, flattened and fragmented and flared, irregular metaphyses. Platyspondyly in the spine with wide intervertebral spaces is observed and some vertebral bodies are pear-shaped with central humps, anterior protrusions and posterior scalloping.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 1 F5/8 type C domain.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 3 μg ab222446 analyzed by 15% SDS-PAGE.

References

ab222446 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up