Description

  • Product name

    Recombinant Human DDX17 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SPNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGR SSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPP PPPPPPS
    • Amino acids

      621 to 727
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153094 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ddx17
    • DDX17_HUMAN
    • DEAD (Asp Glu Ala Asp) box helicase 17
    • DEAD (Asp Glu Ala Asp) box polypeptide 17
    • DEAD box helicase 17
    • DEAD box protein 17
    • DEAD box protein p72
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 17
    • P72
    • Probable ATP-dependent RNA helicase DDX17
    • RH70
    • RNA dependent helicase p72
    • RNA-dependent helicase p72
    see all
  • Function

    RNA-dependent ATPase activity.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the DEAD box helicase family. DDX5/DBP2 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab153094 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153094 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153094.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up