Overview

  • Product name

    Recombinant Human DDX18 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      KNYFLHKSAQEAYKSYIRAYDSHSLKQIFNVNNLNLPQVALSFGFKVPPF VDLNVNSNEGKQKKRGGGGGFGYQKTKKVEKSKIFKHISKKSSDSRQFSH
    • Amino acids

      571 to 670
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160245 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP dependent RNA helicase DDX18
    • ATP-dependent RNA helicase DDX18
    • DDX 18
    • DDX18
    • DDX18_HUMAN
    • DEAD (Asp Glu Ala Asp) box polypeptide 18
    • DEAD box polypeptide 18
    • DEAD box protein 18
    • FLJ33908
    • MrDb
    • Myc regulated DEAD box protein
    • Myc-regulated DEAD box protein
    see all
  • Function

    Probable RNA-dependent helicase.
  • Sequence similarities

    Belongs to the DEAD box helicase family. DDX18/HAS1 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Information by UniProt

Images

  • ab160245 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160245 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160245.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up