Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      REGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGR TGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIA
    • Amino acids
      380 to 478
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161386 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP-dependent RNA helicase DDX19B
    • DBP5
    • Dbp5, yeast, homolog of
    • DD19B_HUMAN
    • DDX19
    • DDX19B
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 19B
    • DEAD box protein 19B
    • DEAD box RNA helicase DEAD5
    • DEAD-box protein 5
    • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 19 (Dbp5, yeast, homolog)
    • DEAD/H BOX 19
    • helicase DEAD5
    • RNAh
    • TDBP
    • yeast Dbp5 homolog
    see all
  • Function
    ATP-dependent RNA helicase involved in mRNA export from the nucleus.
  • Sequence similarities
    Belongs to the DEAD box helicase family. DDX19/DBP5 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Cytoplasm. Nucleus > nuclear pore complex. Nucleus membrane. Nuclear pore complex cytoplasmic fibrils.
  • Information by UniProt

Images

  • ab161386 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161386 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161386.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up