Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFL LKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVL ATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGG LSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKM LEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFV DDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQVIIFVKSVQRCM ALAQLLVEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGM DIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILN DVQDRFEVNVAELPEEIDISTYIEQSR
    • Amino acids

      1 to 427
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP dependent RNA helicase DDX39
    • ATP-dependent RNA helicase DDX39A
    • BAT1
    • BAT1L
    • DDX39
    • DDXL
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 isoform 2
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 39A
    • DEAD box protein 39
    • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 39
    • Eukaryotic initiation factor 4a
    • Nuclear RNA helicase URH49
    • Nuclear RNA helicase, DECD variant of DEAD box family
    • UAP56 related helicase
    • UAP56 related helicase, 49 kDa
    • URH49
    • wu:fc87b12
    • zgc:55881
    see all
  • Relevance

    DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX39 encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants encoding different isoforms.
  • Cellular localization

    Cytoplasmic and Nuclear

Images

  • ab160882 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160882 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up