Overview

  • Product name
    Recombinant Human DDX42 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYMAENPT AGVVQEEEEDNLEYDSDGNPIAPTKKIIDPLPPIDHSEIDYPPFEKNFYN EHEEITNLTPQQLIDLRHKLNLRVSGAAPPRPGSSFAHFGFDEQLMHQIR KSEYTQPTPIQCQGVPVALSGRDMIGIAKTGSGKTAAFIWPMLIHIMDQK ELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAVYGGGSMWEQ AKALQEGAEIVVCTPGRLIDHVKKKATNLQRVSYLVFDEADRMFDMGFEY QVRSIASHVRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIGEANE DVTQIVEILHSGPSKWNWLTRRLVEFTSSGSVLLFVTKKANAEELANNLK QEGHNLGLLHGDMDQSERNKVISDFKKKDIPVLVATDVAARGLDIPSIKT VINYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTPKDSNFAGDLVRNLEG ANQHVSKELLDLAMQNAWFRKSRFKGGKGKKLNIGGGGLGYRERPGLGSE NMDRGNNNVMSNYEAYKPSTGAMGDRLTAMKAAFQSQYKSHFVAASLSNQ KAGSSAAGASGWTSAGSLNSVPTNSAQQGHNSPDSPVTSAAKGIPGFGNT GNISGAPVTYPSAGAQGVNNTASGNNSREGTGGSNGKRERYTENRGSSRH SHGETGNRHSDSPRHGDGGRHGDGYRHPESSSRHTDGHRHGENRHGGSAG RHGENRGANDGRNGESRKEAFNRESKMEPKMEPKVDSSKMDKVDSKTDKT ADGFAVPEPPKRKKSRWDS
    • Amino acids
      1 to 819
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161416 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP-dependent RNA helicase DDX42
    • DEAD (Asp-Glu-Ala-Asp) box polypeptide 42
    • DEAD box polypeptide 42 protein
    • DEAD box protein 42
    • EC 3.6.1.-
    • FLJ43179
    • RHELP
    • RNA helicase-like protein
    • RNA helicase-related protein
    • RNAHP
    • SF3b DEAD-box protein
    • SF3b125
    • SF3b125 DEAD-box protein
    • Splicing factor 3B-associated 125 kDa protein
    see all
  • Relevance
    This gene encodes a member of the Asp-Glu-Ala-Asp (DEAD) box protein family. Members of this protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Two transcript variants encoding the same protein have been identified for this gene.
  • Cellular localization
    Cytoplasm. Nucleus speckle. Nucleus> Cajal body. Note: Isoform 2 is present in Cajal bodies (CBs) and nuclear speckles.

Images

  • ab161416 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161416 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161416.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up